SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013810 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013810
Domain Number 1 Region: 503-693
Classification Level Classification E-value
Superfamily Fibronectin type III 7.43e-46
Family Fibronectin type III 0.0000309
Further Details:      
 
Domain Number 2 Region: 804-1000
Classification Level Classification E-value
Superfamily Fibronectin type III 5.06e-37
Family Fibronectin type III 0.0000159
Further Details:      
 
Domain Number 3 Region: 218-313
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-24
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 300-395
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-24
Family I set domains 0.005
Further Details:      
 
Domain Number 5 Region: 404-499
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-21
Family Fibronectin type III 0.0000481
Further Details:      
 
Domain Number 6 Region: 115-210
Classification Level Classification E-value
Superfamily Immunoglobulin 4.29e-19
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 694-790
Classification Level Classification E-value
Superfamily Fibronectin type III 2.61e-18
Family Fibronectin type III 0.00000556
Further Details:      
 
Domain Number 8 Region: 18-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000109
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013810   Gene: ENSMODG00000011028   Transcript: ENSMODT00000014063
Sequence length 1403
Comment pep:novel chromosome:BROADO5:3:72664835:73634797:-1 gene:ENSMODG00000011028 transcript:ENSMODT00000014063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSAIGSQIKSFTSLRFLSEPSDAITMRGGNVLLNCSAESDKGVPVIKWKKDGVHLAQA
MDERKQQLPNGSLLIQNIVHSRHHKPDEGLYQCEASLGDYGAIISRTAKVSVAGPLRFLS
QTESVTAFMGDTVLLKCEVVGEPMPIIHWQKNQEDLVLNPGDSRIVILPSGALQISRLQP
GDNGIYRCLARNPASSRTGNEAEIRILSDPGLHRQQFFLQRPSNVVAIEGKDAILECCVS
GYPPPSFTWIRGEEVIQVRSRKYSLLGGSNLLISNVTDDDTGTYTCVVTYKNENISASAE
LTVLVPPWFLIHPSNLYAYESMDIEFECAVSGKPVPTVNWMKNGDVVIPSDYFQIVGGSN
LRILGVVKSDEGFYQCVAENEAGNTQTSAQLIIPEPAIPSSSVLPSAPRDVVPVLVSSRF
VRLSWRPPAETRGNVQTFSVFFSREGDNRERAMNTSQPGSLQLTVGNLKPEATYTFRVVA
YNERGPGESSQPIKVATQPELQVPGPVENLQAISTSPTSILISWEPPAYANGPVQGYRLF
CTEASTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLAYNRYGPGVSTDDLTVVTLSDVPSA
APQNVSLEVVNSRSIKVSWLPPPPGTQNGFITGYKIRHRKTTRRGEMETLEPNNLWYLFT
GLEKGSQYSFQVAAMTVNGTGPSSDWHTAETPENDLDETQVPDQPSSLHVRPLTTSIVMS
WTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIEKLEPSSHYVISLKAFNNAGE
GVPLYESATTRSMTVPDISTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTTEVRFYT
VRWRTSFSASAKYKSADITSLSHTATGLKPNTMYEFSVMVTKGQRSSTWSMTAHATTYEA
APTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLDKNTPIDDWIMESISG
DRLTHQIMDLNLDTVYYFRIQARNSKGVGPLSDPIVFRTLKVEHPDKMANDQGRHGDGGY
WPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICT
RRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGSDQAGRDSPIQG
CQDITPVSHSQSETQLGSKSTSHSGPDADETGSTMSTLERSLAARRATRAKLMIPMDSQP
NNPTVVSAIPVPTLESAQYPGILPSPTCGYPHPQFTLRPVPFPTLAVDRSFGTGRTVSEG
PTPQQPPMLPQTQPEHPSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYT
PLLSQTGPTLAKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEEGHKQPEDPANVYEQDD
LSEQMASLEGLMKQLNAITGSAF
Download sequence
Identical sequences F7F4D5
ENSMODP00000013810 ENSMODP00000013810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]