SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013894 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013894
Domain Number 1 Region: 24-259
Classification Level Classification E-value
Superfamily L domain-like 6.12e-44
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 260-369
Classification Level Classification E-value
Superfamily Immunoglobulin 7.26e-18
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013894   Gene: ENSMODG00000011100   Transcript: ENSMODT00000014147
Sequence length 510
Comment pep:novel chromosome:BROADO5:3:436795490:436800029:-1 gene:ENSMODG00000011100 transcript:ENSMODT00000014147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGESMLSSLLPILSLLLLRGQGCPTACRCYSMTVECGSLSLQNVPPGIPPVTQTVFLQ
DNSITQIHQADLAPLSGLQYLYMQNNSLWALEPGAFLGQQQLLELALNRNRIHLLDSSIF
KGLEHLRVLYLAGNQITRLLDFTFCYLPRLQELHLQENSIELLEDQALAGLSSLALLDLS
KNQLSTISQAVLVPLASLQVLRLTENPWRCDCALHWLGAWIKDGGQRLLSSLDKKIVCSE
PPRLAHQSLLDISGNSLICIPPTVHVEPLEAMAQLGDDLRVSCQASGYPQPLVTWRKVAQ
SRLGLPRARVRLVGGAPGMSEGILGEHLASDTGSGMLSLTNITMAHAGKYECEATNPGGT
TRMPFHLLVNLSQQQLPRPPPPASGAVSREPLYEAGSMDFYALXXXXXXXXXXXXXXXXL
TALLLTIMICYKTGKRKKAKQEESVLYVNDYSDGPTTFAQLEEYRDERGHEMFVINRNKP
LFPTYEDSGSEPLQDPGLLFQPQIAYEIHC
Download sequence
Identical sequences F7DL38
ENSMODP00000013894 ENSMODP00000013894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]