SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013905 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013905
Domain Number 1 Region: 39-99
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013905   Gene: ENSMODG00000011108   Transcript: ENSMODT00000014158
Sequence length 116
Comment pep:novel chromosome:BROADO5:5:302069721:302104914:1 gene:ENSMODG00000011108 transcript:ENSMODT00000014158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNSSLCPENPEGGKEVTKARTGSLESQGMAFERDRLPAQVVVTFKDVAVDFTQEEWRL
LTPPQKVLYREVMLENAQNLLSVGLALPRADVISYLEQKEAPWMLEEEGLKSSCTG
Download sequence
Identical sequences F7BBQ6
ENSMODP00000013905 ENSMODP00000013905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]