SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013953 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013953
Domain Number 1 Region: 97-185
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000103
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 188-279
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000167
Family I set domains 0.04
Further Details:      
 
Domain Number 3 Region: 284-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000465
Family I set domains 0.042
Further Details:      
 
Domain Number 4 Region: 380-460
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000294
Family I set domains 0.051
Further Details:      
 
Domain Number 5 Region: 25-86
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000156
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013953   Gene: ENSMODG00000024540   Transcript: ENSMODT00000014208
Sequence length 617
Comment pep:novel chromosome:BROADO5:2:168841828:168879128:1 gene:ENSMODG00000024540 transcript:ENSMODT00000014208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWTSLLILVSINGQLCIAVAQKAVVIPSPPWTPVFRGEKVTLTCKGFHLLIPKKSWWF
YEAQWQEKSNPIEVKKYGEYRCHFQDLDFSDPVYPMFSNEWLILQTPYFVFEGDTLNLKC
RGWEDASLKKISYYQNRSLISGASENSLLSIPRARLRHSGWYYCRATFKKQNFVRTSKEL
ELQVQELFPSPKLKTTTSQPIEGTSVTLNCETQLPPQRSDTELHFSFFRDGRTITSNGKN
SQELQIPAIWWEDSGSYWCEAKAVTQDVYRQSKHMKIHVKRIPLSGILLETLPSETQVIE
GEKLILICSVAEGTGNITFCWLKDDTKECLKKKTQHSLKEELVLSMMKSDEGKYHCVADN
NISTIISNSVAITVIIPVARPLLTLSAIGMQAIVGDVVEFRCEALRGSAPIFYQFYHKDF
ILKKILAPLGGAVSFNLSVTPEHSGNYYCKANNTFNGHFSEMLSLSISDPKKRRLLIMGV
TVSLLGILVFAAIALLVYFKFQRKSGGSSAPEPSRDLPVTHLQESGHLKSTTPVELQSVY
DNVAPFIEDVIYSEIWSINQGRLDTANNSESSLEKADSSVVYSGVKRYSPSNSTRKDKTV
DRNHEDATENYENILFS
Download sequence
Identical sequences F7ANN1
XP_007481742.1.35504 ENSMODP00000013953 ENSMODP00000013953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]