SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013956 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013956
Domain Number 1 Region: 125-218
Classification Level Classification E-value
Superfamily Immunoglobulin 8.27e-16
Family I set domains 0.041
Further Details:      
 
Domain Number 2 Region: 24-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000677
Family I set domains 0.035
Further Details:      
 
Domain Number 3 Region: 215-304
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000314
Family I set domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013956   Gene: ENSMODG00000011151   Transcript: ENSMODT00000014211
Sequence length 386
Comment pep:novel chromosome:BROADO5:2:168889674:168916985:1 gene:ENSMODG00000011151 transcript:ENSMODT00000014211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPPGNSDTHCSGHYVWLFPIELFPPPELKVTSYQPIEGTPIALSCDTQLPPQKSDTELH
FTFFRDGRTITSDWMRSRVLQIPAIWREDSGSYSCEARAVAQDIRKQSKGVKINVKRIPI
SGIIMKTEPSRGQVTEGEKLVFICSVTQGTGNITFSWHREGINASLGKKTRYSLEEKLIL
PAINESDAGKYYCTADNNINTISSLTVKITVKIPVSRPLFTLSTLRTQVTVGDVVQFQCK
ALRGSLPIQYQFYHDGEIFENKIDPSGSAASFNLSMKTGHSGNYFCKAINSFSDQCSEIK
KLSVSEPIRSQRNIIIMGVAIALIVIFILTAIALVLCFRLQRKSVNPTTEDIVYSEIWST
QQGKAINPTVGDVVYSEVCSKEHGKE
Download sequence
Identical sequences F7ANL1
ENSMODP00000013956 ENSMODP00000013956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]