SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013962 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013962
Domain Number 1 Region: 76-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000389
Family I set domains 0.006
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000992
Family I set domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013962   Gene: ENSMODG00000029596   Transcript: ENSMODT00000014217
Sequence length 173
Comment pep:novel chromosome:BROADO5:2:168888520:168889645:1 gene:ENSMODG00000029596 transcript:ENSMODT00000014217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLSPQWTTIFEGEKVNLTCDGSDTSKLRIRWLLNNEQLKYSTKRIETMRPGEYKCQDQ
HSALSDPVHLVVSPDPLILQTPYSVFEGDTLVLRCRTKYDARVRNMKYYKDGKILSYFLK
NSVFVIPQVGLSHSAQYHCTATTDLLQIFQQEIRSRKVALQIQGKNLNPGGRV
Download sequence
Identical sequences F7AN28
ENSMODP00000013962 ENSMODP00000013962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]