SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013971 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013971
Domain Number 1 Region: 108-191
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000813
Family I set domains 0.0038
Further Details:      
 
Domain Number 2 Region: 489-579
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000126
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 298-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000526
Family I set domains 0.047
Further Details:      
 
Domain Number 4 Region: 395-485
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000157
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 205-287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000525
Family V set domains (antibody variable domain-like) 0.041
Further Details:      
 
Domain Number 6 Region: 25-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000367
Family I set domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013971   Gene: ENSMODG00000024538   Transcript: ENSMODT00000014226
Sequence length 619
Comment pep:novel chromosome:BROADO5:2:168982556:168995148:1 gene:ENSMODG00000024538 transcript:ENSMODT00000014226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLTITAVILNSSNFTPFLFFISAAQKPVISLLPPWPTLFKGEQEFLRCNVFQFYATEET
QWYINMKPLQETWSYIKVEKSGQYQCRIQNSPLSNPVFLSSLRDDLILWTTYPVFEGDSL
VLSCLAKDESKLIEVTYYKNGRKLAYFKEHSNYSIPKAELSNSGQYHCSARNLIWIIPLF
TLKANPVTIQVQELFPLPILRSTILEPSEETPVTLSCETQLPPEKENIQLHFSFFRYGRI
ISSGQKRAPKLQLSKVQKEDSGAYFCVAETVTSGVRKKSHPVWIQVQRIPVFGIHLEVNP
PGGQLTEGQTLALLCSVAGGTGNIMFSWHKEGTETVLKKKTQRSLVAEFEILTISENEAG
KYYCTANNINRQLRSKSVSISVKTPSDLSFSVSVPVSPPILTFSTPQAQTFVGKVVELGC
KVQRGSGPILYRFYHEGKIIKNSSAPLGGAASFNLSLTEQHSGNYSCEADNGIAVQFSKV
LTLSVKVPVSRPLLILSAPKPQATAGDMVELRCEAKKGTTPILYRFFRQDTILETGWAFL
GEAAFLNLSLTTEDSGIYSCEADNGFGPQLSEGVKLSVTVPTGKQRSLLAGGVSGGLLSF
LGLLGAAFLLYFRTRKRTG
Download sequence
Identical sequences F6ZZU7
13616.ENSMODP00000013971 ENSMODP00000013971 ENSMODP00000013971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]