SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013977 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013977
Domain Number 1 Region: 263-351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000264
Family I set domains 0.036
Further Details:      
 
Domain Number 2 Region: 86-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000253
Family I set domains 0.0075
Further Details:      
 
Domain Number 3 Region: 174-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000169
Family I set domains 0.033
Further Details:      
 
Domain Number 4 Region: 3-71
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000256
Family I set domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013977   Gene: ENSMODG00000011170   Transcript: ENSMODT00000014232
Sequence length 399
Comment pep:novel chromosome:BROADO5:2:168943531:168948182:-1 gene:ENSMODG00000011170 transcript:ENSMODT00000014232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KASVFISPPWTTFFIGEKVFLTCDGFQFYEQGKTQWYQNGKLLQEISENNITINKSGKYR
CKINNSPLSDIVKLTFFRVSLILRIPYLIFEGDSLILRCQEKNNHSLTKVTYYKNSKSFS
AFNQSSDVVIPQASLSNRSSYHCTAFKNIVWKKSNEVTLDIHVVFTSSLETIDSQPKEGS
PVTLSCKVWIPLEKSSIQLLFSFFRDPGVILLGQARAQELQISKFWMEDSGLYWCKVETV
SLSVSKQSRPIRMSVMRIPISGVHMEVQPHGGHIMEGQKLVLLCSVIGGSGTITFSWHRK
DTEASLGKKIQHSLVAEFVFSAVRESDAGKYYCTADNNSSLIPSHSVTITVRNSFSFFSV
PEGNGKDSLAVGITMALISAFGLTVVLLIYFKKQKKSGL
Download sequence
Identical sequences F6ZZQ4
ENSMODP00000013977 13616.ENSMODP00000013977 ENSMODP00000013977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]