SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014153 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014153
Domain Number 1 Region: 5-172
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 9.61e-27
Family MHC antigen-recognition domain 0.0016
Further Details:      
 
Domain Number 2 Region: 181-272
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-19
Family C1 set domains (antibody constant domain-like) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014153   Gene: ENSMODG00000011316   Transcript: ENSMODT00000014415
Sequence length 308
Comment pep:novel chromosome:BROADO5:1:705293348:705295943:-1 gene:ENSMODG00000011316 transcript:ENSMODT00000014415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSVHHSHIGQFTAVGTAHSLLELSAINFLNDIEVGSYNKAHKQIIVKIPWISKALGVNNI
IKKINLLVEHEQHFRWTIQFLSRNDTNHNRNHTAQLLAECEIDNNITVKSHIYLIWDGVE
YFRIDEEVGHWENINPEFKEYQHILESPFWTTLRKRYMKLYCVDLMRKIVGYSSIRDNVV
PEVAVSQHVSPEGSIILSCIASGFYPRSILMSWEKYGKLGIWGNESSSGTLPNMDSTFYL
KVTLELPPEDSGAGYTCVVEHSELKSPAIYSVPGKSTVEKSWVLELGIVLAIILLLSCAG
AIIIWKKR
Download sequence
Identical sequences F6WJ49
ENSMODP00000014153 13616.ENSMODP00000014153 ENSMODP00000014153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]