SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014240 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014240
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.1e-25
Family MHC antigen-recognition domain 0.0022
Further Details:      
 
Domain Number 2 Region: 167-256
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-20
Family C1 set domains (antibody constant domain-like) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014240   Gene: ENSMODG00000011387   Transcript: ENSMODT00000014504
Sequence length 291
Comment pep:novel chromosome:BROADO5:1:705355578:705358098:1 gene:ENSMODG00000011387 transcript:ENSMODT00000014504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLELSGISFLDDVEVLSYNKAHKQIVFKIPWISKALGVKYLTELHDLLVKQEQDLRWTIE
IVARNDTNHNRNHTAQLLAECEIDNDILVKSHIHLIWDGEECFRIDEEDGHWENVNPEFK
QYQHILGSPLWTTLRKQYMKIYCVDGIRKIIGHSSIRDNVVPEVAVSQHVSPEGSIILSC
IASGFYPRSILMHWERNGKLGIWGNESSSGTLPNMDSTFYLKVTLELPPEDSGAGYTCVV
EHSELKSPAIYSVPRKPTMNKSWILALGITLAVILLLSCAGAFIIWKKKTG
Download sequence
Identical sequences F6SNT0
ENSMODP00000014240 ENSMODP00000014240 13616.ENSMODP00000014240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]