SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014257 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014257
Domain Number 1 Region: 14-170
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 7.3e-28
Family MHC antigen-recognition domain 0.0013
Further Details:      
 
Domain Number 2 Region: 177-266
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-17
Family C1 set domains (antibody constant domain-like) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014257   Gene: ENSMODG00000011403   Transcript: ENSMODT00000014521
Sequence length 318
Comment pep:novel chromosome:BROADO5:1:705494729:705503170:-1 gene:ENSMODG00000011403 transcript:ENSMODT00000014521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHHRLEGEFIAVGTRHSLFNFTIIHVIDDVLVCTYDKGNKQTVFNGAWITRALGKDFTEN
KKEFNLSAETYFRWLLSFFIKKDTKSNKNHTIQLYGECELDNDIYIGSQIQFAVDGEDFI
RTNDKMEHWIVTKPEAEHFRTIAESTLGVNLRKKVMKHYCAEMIRKILHYSNLKENVAPE
VTVSRHDVSDGRVAFNCTATGFYPRSIMMRWEKGGQLGVWGQESSSGTLPNADSTFYLQI
TLELPPGDSGAGYACVVEHNKLQAPAVHPGESWVLVLGLLTAIILVLSCSGAFILWNKKT
GMYVRRQGEKTNCPSKRS
Download sequence
Identical sequences F6S6I3
13616.ENSMODP00000014257 ENSMODP00000014257 ENSMODP00000014257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]