SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014281 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014281
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.58e-35
Family MHC antigen-recognition domain 0.00051
Further Details:      
 
Domain Number 2 Region: 176-270
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-18
Family C1 set domains (antibody constant domain-like) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014281   Gene: ENSMODG00000011424   Transcript: ENSMODT00000014545
Sequence length 298
Comment pep:novel chromosome:BROADO5:1:705690267:705693318:1 gene:ENSMODG00000011424 transcript:ENSMODT00000014545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHHRHDFYFTATGSSGSFLDFIVNSVVDDVQLCSYHKEKHQLVMKEDWMYQALGASEIAQ
KQQKLLDLEKNFQWAFKNLIKNEAKSGKNHTLQVFVNCEVDKDILVSSHFQFALDGEDFC
QMDEQPEHWIAMKPEAQHFKFLWDSAFWKRRVRHYIQEDCIDGMNKVLQHSSMRENVPPE
VTVSRYDAPDGRVTFSCRATGFYPSSILLHWEKDGALGVWGQESSSGTLPNADATFYLQV
TLELPPGDPGTGYICVVEHSELETPAMFPVPGKPHMERPSVIAMSILAVIIVVLSCAG
Download sequence
Identical sequences F6RKI0
ENSMODP00000014281 13616.ENSMODP00000014281 ENSMODP00000014281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]