SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014345 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014345
Domain Number 1 Region: 17-512
Classification Level Classification E-value
Superfamily Sema domain 4.32e-163
Family Sema domain 0.00000000016
Further Details:      
 
Domain Number 2 Region: 508-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 577-658
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000409
Family V set domains (antibody variable domain-like) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014345   Gene: ENSMODG00000011476   Transcript: ENSMODT00000014611
Sequence length 760
Comment pep:novel chromosome:BROADO5:6:276653887:276676949:1 gene:ENSMODG00000011476 transcript:ENSMODT00000014611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSVLVTLGAGKSSSLPRLQLSYRDLLATNRSTIFLGPRGKLDLRALYLDEYRDRLFLG
GRDTLYSLRLDQAGPDPKEILWPPRPGQKEECILKGRDPLTECANYVRVLHPYNRTHLLA
CGTGAFQPLCALVAVGHRGEHVLSLDQASVEGGRGRCPHEPDRPFSSTFVGGELYTGLTA
DFLGREAVLFRSGGARPALRSDTDQSLLHDPRFVGAALIPDNADRDNDKVYFFFSEAAAP
PEGGSGRAIVSRVGRICVNDAGGQRVLVNKWSTFLKARLICSVPTPGGIDTYFDQLEDVF
LLWPKDGKSPEVYALFSTLSAVFQGFAVCVYHMADIWEVFNGPFAHRDGPQHQWGPYGGK
VPFPRPGVCPSKTTTQPGRPFGSTKDYPDDVLQFTRAHPLMFRSVLPRHGRPILVKTHQP
YRLLQIVVDRVEAEDGAYDVIFLGTDAGSVLKVIAFQTGKSVQPEEVILEEMQVFKVPTP
ILEMEISVKRQMLYVGSRLGVAQLRLHRCETYGNACAECCLARDPYCAWDGDTCTRYQPS
SAKRRFRRQDIRHGNPALQCLGQSHGGDVMGITEATVVFGTEHNSTFLECRPKSPQATVH
WFVQRPKDEQPDQVKTDERILQTEHGLLFRRLNRLDAGTYSCKTLEHGFAQTVARLALEV
IGAEQLEGLFLREHGEEESISKNSASVPSRAWYKDILQLIGYANLPRVEEYCERVWCVDR
YRRKGKQSKSKTWLGTDLGKKAKSRAQGERNRTPREVEAT
Download sequence
Identical sequences F6VJZ6
ENSMODP00000014345 ENSMODP00000014345 XP_001380329.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]