SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014348 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014348
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily Immunoglobulin 7.71e-33
Family V set domains (antibody variable domain-like) 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014348   Gene: ENSMODG00000011538   Transcript: ENSMODT00000014614
Sequence length 135
Comment pep:novel chromosome:BROADO5:1:714441236:714441868:1 gene:ENSMODG00000011538 transcript:ENSMODT00000014614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPSQLLFGLLMLWVPGSRGEVVLTQSPASVSVSPGERVTISCQASESVKDSDGNTYLN
WFQQKPGQSPRLLIYQISKLDSGIPARFGGSGADRNFTFTISSVSAEDGADYYCFQDTFY
PLTVLQARTKTSPEL
Download sequence
Identical sequences F6VJX1
13616.ENSMODP00000014348 ENSMODP00000014348 ENSMODP00000014348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]