SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014360 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014360
Domain Number 1 Region: 23-119
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-35
Family V set domains (antibody variable domain-like) 0.0000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014360   Gene: ENSMODG00000013040   Transcript: ENSMODT00000014626
Sequence length 135
Comment pep:novel chromosome:BROADO5:1:714428089:714434928:1 gene:ENSMODG00000013040 transcript:ENSMODT00000014626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPSQMLFGLLILWVPGSQGKIVLTQSPSSLSASPGERVTINCKASESITYSDGDDLLY
WYQHKPGQAPRCLIYWATNLASGVPARFSGSRSGTDFTLSISSMEPEDAAVYYCQQDYKE
PPTVKYSQTKTSQGS
Download sequence
Identical sequences F6V2R3
ENSMODP00000014360 ENSMODP00000014360 13616.ENSMODP00000014360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]