SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014376 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014376
Domain Number 1 Region: 22-122
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-35
Family V set domains (antibody variable domain-like) 0.0000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014376   Gene: ENSMODG00000011473   Transcript: ENSMODT00000014642
Sequence length 133
Comment pep:novel chromosome:BROADO5:1:714419163:714419873:1 gene:ENSMODG00000011473 transcript:ENSMODT00000014642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPQARLLWLLVLWAQGSQGKIVLTQSPSSLSASPGERVTINCKASESITDSFGDDLLYW
FQHKPGQAPRRLIYWATNLASGVPARFSGSRSGTDFTLSISSMKPEDAAIYYCQQGYDIP
PTVKYSSNKNLSR
Download sequence
Identical sequences F6V1N5
13616.ENSMODP00000014376 ENSMODP00000014376 ENSMODP00000014376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]