SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014379 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014379
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily Immunoglobulin 2.68e-35
Family V set domains (antibody variable domain-like) 0.0000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014379   Gene: ENSMODG00000011502   Transcript: ENSMODT00000014645
Sequence length 120
Comment pep:novel chromosome:BROADO5:1:714447543:714448214:1 gene:ENSMODG00000011502 transcript:ENSMODT00000014645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPRAHLLWLLVLWAQGSQGKIVMTQSPSSLSASPGERVTINCKASESITYSDGDDLLYW
YQHKPGQAPRTLIYWATNLESGVPARFSGSRSGTDFTLSISSMEPEDAAIYYCLQTYNVP
Download sequence
Identical sequences F6V1L8
ENSMODP00000014379 13616.ENSMODP00000014379 ENSMODP00000014379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]