SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014510 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014510
Domain Number 1 Region: 77-381
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-48
Family Kelch motif 0.022
Further Details:      
 
Domain Number 2 Region: 1983-2159
Classification Level Classification E-value
Superfamily Fibronectin type III 6.26e-19
Family Fibronectin type III 0.0000325
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014510
Domain Number - Region: 380-421
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000772
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014510   Gene: ENSMODG00000011597   Transcript: ENSMODT00000014778
Sequence length 2194
Comment pep:known chromosome:BROADO5:X:14439633:14467111:-1 gene:ENSMODG00000011597 transcript:ENSMODT00000014778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGLQPAAVVASVSASSSAVAAAGSSSLAQLLQPRWKRVVGWSGPVPRPRHGHRAVAIK
ELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVE
YGKYSNDLYELQASRWEWKRLKAKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDP
KNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYG
GMSGCRLGDLWTLDIETLTWNKPTLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVK
VATHEKEWKCTNTLACLNLDTMSWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDG
YRKAWNNQVCCKDLWYLETEKPPAPSRVQLVRANTNSLEVSWGAVPTADSYLLQLQKYDI
PAAAAAAATATSPAANPVPSVPINPPKSPAPAAAAPAVQPLAQVGITLLPQAAATPPTTT
TTIQVLPTVPGSPIPVPTTGRTQGVPAVLKVTGPQAPAGTPLVTVRPASQPGKAPVTVTS
LPAGVRMVVPTQSAQGTVIGSNPQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVK
TVAVSPGTSTLPATVKVASSPVMVSNPATRMLKTAAAQVGTSVSSAANTPTRPIITVHKS
GTVTVAQQAQVVTTVVGGVTKTITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVT
GQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGTGTKPTILGISSVSP
NTTKPGTTTIIKTIPMSAIITQSGATGVTSSPGIKSPITIITTKVMTSGTGTPAKIITAV
PKIATGHGQQGVTQVVLKGAPGQPGTILRTVPMGGVRLVTPVTVSAVKPTVTTLVVKGTT
GVTTLGTVTGTVSTSLAGAGGHNTNASLATPITTLGTIATLSSQVINPTAITVSAAQTTL
TAAGGLTTPTITMQPVSQPTQVTLITTPSGVEAQPVHDLPVSILASPTTEQPTATVTIAE
SGQGDVQPGTVTLVCSNPPCETHETGTTNTATTTVVANLGSLQQPTQVQFVCDRQEAGAS
LVTSAVGQQNGSVVRVCSNPPCEIHETGTTNTPTVVSANLTVPTLLGTGQFVCSNPPCET
HETGTTNTATSSMAGQHMLSIPSCLPQETGTANLAASSMAGQQVCSNPPCETHETGTTNT
ATMATSNMTGKRVCTNPPCETHETGTTSTATTAMSNMGSGQPATASQQRETYHTYTTNTP
TTARSNMGTREPEKAPALAKPTCQTHQTSATGTTMTVRATEAPCPAAPRVCPSPSCEQST
TATGSTGPVTKSSSASGGSTSTGVGQLAFISRQSEVQHTHTTNTPTTARSNMGAGEANGV
QGPTKPSCQTHQTSSTSTTMTVKATEVLCLAAATAVSSTCSNPPCETHETGTTNTATTSN
AGTLQQVCSNPPCETHETGTTHTATTATSNVGSSQPGQQIPASPHCETHQTTSTGTTMTV
NFGVPPPGPSPSRKTLEAALDSAAAPATASPAPTAPSPGQRVCSNPPCETHETGTTHTAT
TVTSNMSSNQDPPSTTGGQGEPENTQGENMTSTSSNAITTTVSSTQTRAVTAVTQSTPVP
GPSVPNISAMTEMPPDAMTTEASVSATIAVAVTGTDTQEVALSATDILQPLEEIPAETEA
PQQLLQPPSAPPGEQAEGTPATHSPDLQAAVDMSGAGEPSPGQEAASSAVVTAVMVQPQP
QPEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEAAAQAAATEEAQALAIQAV
LQAAQQAVMGAGEPMDTSDAAAVAQAELGHLTAEGQEGQPTSIPIVLTQQELAALVQQQQ
QLQEAQAQVQAQVHHHHHHHHHHLPTEALAPADSLNDPATESNGLSDLAGAVTSTVALLP
STATESLAPSNTFVAPQPVAPSPAKLQAAAALAEKPDPLPPPMKATAKKENQWFDVGVIK
GTNMMVMHYFLPPDDAPSDDDSGTIPDYNQLKKQELQPGTAYKFRVAGINACGRGPFSEI
SAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQAGEPKSS
APAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQ
ESSKDSSTSKPASKRPLSSPEMKSAPKKSKADGQ
Download sequence
Identical sequences F6UZE6
ENSMODP00000014510 ENSMODP00000014510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]