SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014544 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014544
Domain Number 1 Region: 44-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.63e-44
Family Eukaryotic proteases 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014544   Gene: ENSMODG00000011620   Transcript: ENSMODT00000014812
Sequence length 251
Comment pep:novel chromosome:BROADO5:4:207897269:208009996:-1 gene:ENSMODG00000011620 transcript:ENSMODT00000014812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEKQRKGTNMNTILFFGLLSLAVTHLADKKNENSGTKFLAYLKSDYQPCVGTLIHQQWV
VTAAHCYLPFLQVKIGSPNENIKGWLQDQEINYEFLFRHPNFTADSPEHDIMLIKLAKSN
NQHVLVDLPTSINDLDGSICVISGWSQNWKYPFTDADIQINQMARWLSPVQCKGASPRNI
TARSMNNMFCAGMYPHQQNVCQEVSASAAICKGQLHGILSWTDGCVLKGDIGYYTKVYKY
RNWILDIIEKN
Download sequence
Identical sequences F6UGD4
ENSMODP00000014544 ENSMODP00000014544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]