SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014553 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014553
Domain Number 1 Region: 78-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000357
Family I set domains 0.0079
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000256
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014553   Gene: ENSMODG00000027596   Transcript: ENSMODT00000014821
Sequence length 252
Comment pep:novel chromosome:BROADO5:X:7156418:7178632:-1 gene:ENSMODG00000027596 transcript:ENSMODT00000014821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVYYSQDGQASGIGKYKDRVTGTSTPGNASITISNMQPSDSGVYVCDVTNPPDFQGIN
QGLIVANVLVKPSKPYCSIRGTPEANHAISLSCFSAEGAPPPKYQWFKLEEDTIKPVNEQ
YNPTTGLLVIGNLTTFEKGHYQCIASNSLGNSSCEIDLTTGHSEAGIIVGALIGALLAAI
IICLIVWFFMTKSKSKKGKAITKEMQPMTKTLQSSEYESVPAQETAPREVPLSPTEPELL
APNHEEAEGEEK
Download sequence
Identical sequences F6U166
ENSMODP00000014553 ENSMODP00000014553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]