SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014592 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014592
Domain Number 1 Region: 491-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-45
Family SPRY domain 0.0022
Further Details:      
 
Domain Number 2 Region: 178-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.43e-17
Family B-box zinc-binding domain 0.0000182
Further Details:      
 
Domain Number 3 Region: 14-101
Classification Level Classification E-value
Superfamily RING/U-box 8.84e-16
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 4 Region: 388-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000292
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014592
Domain Number - Region: 123-175
Classification Level Classification E-value
Superfamily RING/U-box 0.0106
Family ZZ domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014592   Gene: ENSMODG00000011644   Transcript: ENSMODT00000014860
Sequence length 698
Comment pep:novel chromosome:BROADO5:X:7237365:7337017:-1 gene:ENSMODG00000011644 transcript:ENSMODT00000014860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLNGPARLFSLKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGES
VEPIAAFQCPTCRYVISLTHRGLDGLKRNVTLQNIIDRFQKASLSGPNSPGESCRERTYR
PSPTMSSERIACQFCEQAPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPD
THLRGLMCLEHENEKVNMYCVADDQLICALCKLVGRHRDHQVASLSDRFEKLKQTLEMNL
TNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELMEIIQQRKQAIAVKIKET
KVMKLRKLAQQVANCRQCLERSTVLINQAERILKENDQARFLQSAKNVVERVAMATASSQ
VLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIQEELCTASHDTITVHWLSED
EFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFLVKAIN
QAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGC
YGATGNVFLDSGCHYWEIVMGSSTWYAVGVAYKSAPKNEWIGKNSSSWVFSRCSSNFVVR
HNNKEMLVDVPPQLKRVGVLLDYDNNMLSFYDPANSLHLHTFNVSFILPVCPTFTIWNKS
LMILSGLPVPDFIDYPERHECNCRPQESPYVSGMKACH
Download sequence
Identical sequences F6TIP4
ENSMODP00000014592 ENSMODP00000014592 XP_007507003.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]