SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014923 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014923
Domain Number 1 Region: 168-268
Classification Level Classification E-value
Superfamily Immunoglobulin 2.18e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 48-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.0032
Further Details:      
 
Domain Number 3 Region: 120-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000102
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014923   Gene: ENSMODG00000011907   Transcript: ENSMODT00000015197
Sequence length 300
Comment pep:novel chromosome:BROADO5:1:111321731:111328569:-1 gene:ENSMODG00000011907 transcript:ENSMODT00000015197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRQPSVLAPALAVLLFLQPLPPAGSRPPSGPEYLRRGWQRLLDEGEGCGPCQPEECPTP
RGCLAGRVLDACDCCWECANLEGQLCDLDPEGHFYGRCGEHLECRLDAGGDLQRGEVPEP
QCLCRSTSPLCGSDGRTYAQICSFQEAARAWPQANLSVMHSGPCEAEPQILSPPRDIWNV
TGQDVIFGCEVFAYPMASIEWRKDGTETLLPGDDPHISVQFRGGPQRFEVTGWLQIQAIR
SSDEGTYRCLARNALGQTTASASLTVFTLDQLNNTNISLLNSLNPTPEEEYDNEEEDDYY
Download sequence
Identical sequences F7EGQ0
ENSMODP00000014923 ENSMODP00000014923 XP_001379416.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]