SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015001 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015001
Domain Number 1 Region: 70-166
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-25
Family SH2 domain 0.0000478
Further Details:      
 
Domain Number 2 Region: 202-250
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000000641
Family SOCS box-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015001   Gene: ENSMODG00000011974   Transcript: ENSMODT00000015276
Sequence length 251
Comment pep:novel chromosome:BROADO5:6:205360001:205368429:-1 gene:ENSMODG00000011974 transcript:ENSMODT00000015276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFCIQGPHPLLEEERIGRLTLAGLTVGLPEPVMQPLSVTPFQEEEEAPPLTENELPQVR
DPEEDLLCIAKTFTYLRESGWYWGSLTAFEAKQHLQKMPEGTFLVRDSTHPSYLFTLSVK
TNRGPTNVRIEYADSKFRLDSNCLSKPRILAFPDVVSLIQHYVTSCTTDGKNDTPYPPPA
SLLPTHKDTVPTTAAVAAVHLKLIQPFVRKNSAPSLQHLCRLTINKLTAEVDQLPLPKRI
GDYLRQYPFQL
Download sequence
Identical sequences F7BA11
ENSMODP00000015001 XP_001378784.2.35504 ENSMODP00000015001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]