SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015026 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015026
Domain Number 1 Region: 38-503
Classification Level Classification E-value
Superfamily Sema domain 3.14e-144
Family Sema domain 0.00000000929
Further Details:      
 
Domain Number 2 Region: 505-534
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000746
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 570-655
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000201
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015026   Gene: ENSMODG00000011993   Transcript: ENSMODT00000015302
Sequence length 845
Comment pep:novel chromosome:BROADO5:1:111430644:111438749:-1 gene:ENSMODG00000011993 transcript:ENSMODT00000015302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEGLGSLLLCLLMVSSAPGPPPRRPARELDATPRTTIPYEELSEARHFGGRAHNYSTLL
LEEASGRLLVGARGALFSLNAQDIGDGTHREIRWEASPETQSECVRKGRNNQTECFNHVR
FLQRLNATHLYACGTHAFQPLCAAIDSEAFTLPRSFEEGKEKCPYDPARGYTGLIIDGGL
YTATRYEFRSIPDIRRSRHPRSLRTEESPLHWLNDAEFVFSVLIRESEASTVGDDDKVYY
FFTERATEEGSGFSQSRGHRVARVARVCKGDLGGKKILQKKWTSFLKARLACHVPLYETL
RSVCSLDGGAWAHTRFYAAFSLAAQWRTLEASAICRYDLSDIQASFSGPYMEYLDGTRRW
GRYDGAVPEPRPGSCITDGLRRRGYNSSQDLPSPVLDFVKLHPLMARGVGPARGRPLLLK
RNARYTRLVGTPVTVPAGPTYDVLFLGTVDGWIHKAVVLGLGMHIIEEAQAFLEPQPVES
LVISAAQHSLYVGAPGGVVQMPLSRCSRYSSCYDCILARDPYCGWDPRGRGCREAAVAPN
RYRGPRTALIQDMERGNRGCEGGADTGPHLPPRNRSVLRGDDVLLPCDQPSNLARASWLL
NGSRVLMDGRDGYRVGVDGLLVMDTRPEQSGHYSCYAEENGLRTLLASYGLTVQPILSAP
ALAPGPPPPSHGAHLSPDVRLLYVLIIAALGGLCLVLASMLLYVVCLRGSGRRRTYSLAR
GTGRAGGSAVQLQTVSGQCPGDEDEGEEGTDRAGGPEGGGLLIIPGEGTPAPPPPPPAAP
RAELSNGVGALPSRLRRMNGNSYVLLQQSENRAPTLPCSFTEELSRILEKRKHTQLVERL
DESSV
Download sequence
Identical sequences F7B995
ENSMODP00000015026 ENSMODP00000015026 13616.ENSMODP00000015026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]