SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015268 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015268
Domain Number 1 Region: 26-516
Classification Level Classification E-value
Superfamily Sema domain 4.32e-183
Family Sema domain 0.00000000000791
Further Details:      
 
Domain Number 2 Region: 512-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000296
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 576-659
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000498
Family V set domains (antibody variable domain-like) 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015268   Gene: ENSMODG00000012194   Transcript: ENSMODT00000015553
Sequence length 764
Comment pep:novel chromosome:BROADO5:6:204311914:204324641:1 gene:ENSMODG00000012194 transcript:ENSMODT00000015553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPALALLWALVLGAERSPANSLPRLRLSFQELWARHGLRTFSLPRTCCYEALLLDEERG
RLFVGAQNHVASLSLDNISKQDKKLAWPAPVEWREECNWAGKDISAECVNFVKLLHPYNR
THLYVCGTGAFHPVCGFLEVGYRMEEPMLKLVVNSLEDGKGKSPYDPKHRAASVLVGQEL
YSGVATDLMGRDFTIFRSLGRRPNLRTEQHDSRWLNEPTFVKVFWIPESENPDDDKIYFF
FREVAVEGNPGLGRASVSRIGQICRNDLGGQRSLVNKWTTFLKARLVCSVPGVDGASDSV
FDELRDVFLLPTKDRRSPLLYAVFSTSSNVFQGSAVCVYSMNDVRRAFLGPFAHKEGPNY
QWVSYQGRVPYPRPGMCPSKTFGTFGSTKDFPDDVIQFARNHPLMYNPILPVGGRPIFLQ
TGIDYSFTQIVADRVAATDGHYDVLFIGTDIGTVLKVISVPKDSWQSTEGLLLEELQVFE
NAVAIINMQISSKRHQLYVASQSGISQLPLHRCAAYGRACAECCLARDPYCAWDGAACTR
YLPNTKRRYRRQDVRNGDPNILCSGDPPRQTLLEKKLFGVEGSSTFLECQPKSLQAQVLW
TYQRASDSPRTQVHLDDRVIQIDRGLLLLSLGPQDTGFYHCHATEHGFTQPLRRFTLRVV
GAHQAEQLTRGEEAQGMGAGSPASHKLWYRDFLQLVDAPGRGGGGPMCPPSWSSAKEPHL
PSVLGPRPKGHKWKHLEEKRKGRNRRTHPPDPPRADRGPRSATQ
Download sequence
Identical sequences F7CEG7
ENSMODP00000015268 XP_001378534.2.35504 ENSMODP00000015268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]