SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015332 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015332
Domain Number 1 Region: 159-214
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000000699
Family Excinuclease UvrC C-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015332   Gene: ENSMODG00000012243   Transcript: ENSMODT00000015618
Sequence length 216
Comment pep:novel chromosome:BROADO5:1:427758742:427770776:-1 gene:ENSMODG00000012243 transcript:ENSMODT00000015618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEATFSSTGLLQVPFGHVIGSEKWRGSQLAQEMQGKIKLIFEEGLAPVDFHLSNRFCI
LYITEADLVAGNNYKKRIVQLRNASNLQGIIIVEKTQMSEQYFTTVQKFVVLELGMTLLP
VSNQMEASQLIIQLVHEQTKERNRNPFLKKKSCQLCESSVLQTVQQIPGVGKVMALLLLQ
EFPSIQKLSNASIQELERVVGHTLAEKMHTFFTQIR
Download sequence
Identical sequences F6YH73
ENSMODP00000015332 XP_001367306.1.35504 XP_007474831.1.35504 XP_007474832.1.35504 XP_007474833.1.35504 ENSMODP00000015332 13616.ENSMODP00000015332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]