SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015356 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015356
Domain Number 1 Region: 350-446
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-24
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 249-342
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-22
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015356   Gene: ENSMODG00000012262   Transcript: ENSMODT00000015642
Sequence length 499
Comment pep:novel chromosome:BROADO5:1:328714956:328741482:1 gene:ENSMODG00000012262 transcript:ENSMODT00000015642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNYERPKHFIQSQNTCSSRLQPPGPETSTFSSSQTKQSSILIHPRQCTEQRYSASSTMS
SQITMSSSAFPTSGQQLPGSSLGQRVTSTYNQSPASFLSSVLPSQPDYSGSKNPATVESN
YQQPSVNQPVNVKAAQGAHPKMAPKTPDHEIQGSKEALIQDLERKLRCKDNLLHNGNQRL
TYEERMARRLLGPQNAAAVFQAQNDNESQDSAQHNSENARLQVPVPQIRSRSSSRGDTND
QESILEKFYPPRFVQVPENLSIEEGRFCRIDYKVSGLPAPDVAWYLNGRPVQSDDFHKMI
VSEKGFHSLIFEVVRASDAGTYVCVAKNRAGEATFTIQLDVLAKEHKRAPMFIYKPQSKK
VYEGDSVKLECQVSAIPPPKIFWKRNNEMVQFNTDRISLYHDNSGRITLLIKDANKKDAG
WYTVSAVNEAGVVTCNTRLDVAARPTQTLPNPKQLRVRPTFSKYLALNGKGLDVKQAFNP
EGEFQRLAAQSGLYESEEL
Download sequence
Identical sequences F6YGI0
ENSMODP00000015356 ENSMODP00000015356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]