SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015378 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015378
Domain Number 1 Region: 1-86,119-484
Classification Level Classification E-value
Superfamily Sema domain 5.79e-170
Family Sema domain 0.000000000108
Further Details:      
 
Domain Number 2 Region: 545-629
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000456
Family I set domains 0.047
Further Details:      
 
Domain Number 3 Region: 480-531
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000106
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015378   Gene: ENSMODG00000012283   Transcript: ENSMODT00000015664
Sequence length 726
Comment pep:novel chromosome:BROADO5:6:204069448:204086508:1 gene:ENSMODG00000012283 transcript:ENSMODT00000015664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVGSKDYILSLDLHDINREPLIIHWAASPQRIEECVLSGKNSNGECGNFIRLIQPWNRT
HLYVCGTGAYNPVCTYVNRGRKAQAVELTHTLQARGRGSRATDGAAVSPTVATQHQDYIF
YLEPEKLESGKGKCPYDPKVDSVSALINEELYAGVYIDFMGTDAAIFRTLGKQTAMRTDQ
YNSRWLNDPSFVHAQLIPDSAERNDDKLYFFFREKSTEAPQSPAVYARIGRICLNDDGGH
CCLVNKWSTFLKARLICSVPGPDGIETHFDELQDVFVQQTQDVKNPVIYAVFTSSGSVFR
GSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFTGKMPYPRPGTCPGGTFTPSMKSTKDY
PDEVINFMRTHPLMFNAVYPLQRRPLVVRTNARYRFTTIAVDQVDAADGRYEVLFLGTDR
GTVQKVIVLPKDDMETEELMLEEVEVFKVPAPIKTMTISSKRQQLYVASAVGVTHLGLHR
CHTYGAACADCCLARDPYCAWDGKFCSRYSASSKRRSRRQDIRHGNPIRQCRGFNSNVNK
NTVESVQYGVEGSAAFLECQPRSPQATIKWLFQRDASDRRKELRSEDRTLRTEPGLLLRA
LQLSDAGLYTCTATENNFKHVVTRVQVHVLSREAVHAVLFPPGAAIAALQPPGADPATAS
LRPPTPPYQELAQLLAQPEMGLINQYCQGYWRHAPPNHKEAPGGLKTPELPDQKKPRNRR
NHQPDT
Download sequence
Identical sequences F6YFV8
ENSMODP00000015378 ENSMODP00000015378 XP_007500009.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]