SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015456 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000015456
Domain Number - Region: 200-266
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0276
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015456   Gene: ENSMODG00000012337   Transcript: ENSMODT00000015742
Sequence length 725
Comment pep:novel chromosome:BROADO5:6:279187476:279262779:1 gene:ENSMODG00000012337 transcript:ENSMODT00000015742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWLQLCSFFFTVNACLNGSRLAGAAGPSRRGPSGDTCVWRGVVPVSRNSGLPNVTFKY
DNCTSYPNPVGRHVIADVQNITVSQYACYDQVAITVLWTAGALGIEFLKGFRVILEELKS
EGRQCHQMLLKDPKQLNSSFKRTSMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFF
RTRPCELLLQPDNLACKPFWKPRNLNITQQGPNMQVSFDHAPHNFGFRFYYLHYKLKHEG
PFKRKMCRQEQNSEITSCTLQNVSPGDYIIELLDDTNTTRKMIHYALKPVHSPWAGPIRA
IAITVPLVVISAFATLFTVMCRKKQQAEALMIETLSQETTDWIPVVPFQHMIPSSSSPCL
ASRHSQTSMPTSLVLWLVVMEGTSQVALDLWEDRQICREGQKEWVTQKIRESQFVIVVCS
KGMKYFVEKKSCRHRGGRRGSGGSGDGGELFLVAVAAVAERLRQAKQSSEELGKFIAVYF
DYSCEGDVPGVLDLSAKYKLMDQLPQLYSHLHSRYAGPPDADLYPANLSKRNYFRSKSGR
ALYVAICNMHQFIDQEPNWFEKQFLPFPPPLPHHQDPILEKFDSGLVLNQAAEAAVLGAG
APDPHPLLPRLSLEEDLVSQDMHDGSCVLRPLLHTVKAVSPPDMPRDSGIYDSSVPSSEL
SLPLMEGLLIDQMETSSITGSVSSSSGLGEEEPPVLPSKCIDAGACKAALSGHGFTDELP
ALGPL
Download sequence
Identical sequences F7E2E4
ENSMODP00000015456 ENSMODP00000015456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]