SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015596 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015596
Domain Number 1 Region: 142-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000353
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 24-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000228
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015596   Gene: ENSMODG00000012459   Transcript: ENSMODT00000015885
Sequence length 422
Comment pep:novel chromosome:BROADO5:X:10041849:10063410:1 gene:ENSMODG00000012459 transcript:ENSMODT00000015885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFLGMALLAHLPGLLHAVPTLEGPAKITGPWKGNLKINCTYQPMEGYTQVLVKWLIQQ
DSNPETTIFLRDLSGDHIQQAKYRGRIQVSREAPGDVSLELDTLEMDDRGRYLCQVTWKI
PDGELKVTERTTELQIKKLPASKPVVTTGSGYGFKVPQGMRISLLCQAKGSPPITYKWYK
GEPDGTPTQVATLGTLLFKPAVLSDSGSYFCIAKARVGPEQFSDVVQFVVTDPSKRPTTE
LQPGTLTIRTTPLEATHRATAEPSPRQPTTAGADHAGGSPEGPVMHSGSPSLAPRGRLTI
SPTFTGPGSRGLPLYAIILIILFCTVLLFTVGFVFCRRHTQQDHAYEVARMSTGDVPRVS
IYSGVPAETASEARAPENEYHDEHTSNQDYHIITQANSDYARLLCGSSSAEYEIQENGKT
SC
Download sequence
Identical sequences F6PHT7
ENSMODP00000015596 ENSMODP00000015596 XP_007507014.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]