SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015615 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015615
Domain Number 1 Region: 20-116
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-30
Family V set domains (antibody variable domain-like) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015615   Gene: ENSMODG00000023406   Transcript: ENSMODT00000015904
Sequence length 123
Comment pep:known chromosome:BROADO5:3:524525315:524525811:1 gene:ENSMODG00000023406 transcript:ENSMODT00000015904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLVCLSLLTFCSGSLSQAVVTQPPSASAALGSSARLSCTLSSVSSRYAVGWHQQSPG
KAPRSLLYVDSDGSTGRGDGIPERFSGSGSGTNRFLSISNVQAEDEADYFCQTFYYAGGS
YPS
Download sequence
Identical sequences F6Q428
ENSMODP00000015615 ENSMODP00000015615 13616.ENSMODP00000015615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]