SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015620 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015620
Domain Number 1 Region: 20-120
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-30
Family V set domains (antibody variable domain-like) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015620   Gene: ENSMODG00000023416   Transcript: ENSMODT00000015909
Sequence length 126
Comment pep:novel chromosome:BROADO5:Un:53316637:53317321:-1 gene:ENSMODG00000023416 transcript:ENSMODT00000015909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLSFCSGSLSQAVVTQPPSVSAALGSSARLSCTLSSASSSYDVGWHQQSPG
KAPRYLLYVGSTGGTGRADGIPERFSGSGSGTNRFLSISNVQAEDEADYFCQAFYYRSSS
NFGYTQ
Download sequence
Identical sequences F6Q3P5
ENSMODP00000015620 ENSMODP00000015620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]