SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015623 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015623
Domain Number 1 Region: 23-115
Classification Level Classification E-value
Superfamily Immunoglobulin 4.78e-35
Family V set domains (antibody variable domain-like) 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015623   Gene: ENSMODG00000011573   Transcript: ENSMODT00000015912
Sequence length 128
Comment pep:novel chromosome:BROADO5:1:713884479:713885094:-1 gene:ENSMODG00000011573 transcript:ENSMODT00000015912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSPSQLLCLLVLWAQESRTATVMTQTPASLSVALGETVTISCRASEDISSILAWYQQPP
GKPPKVLIYDADKLESGVPARFSGSRSGTDFTLTISGVQAEDGAHYYCQQYDEFPSHSDG
GLNKNIPR
Download sequence
Identical sequences F6Q3N3
13616.ENSMODP00000015623 ENSMODP00000015623 ENSMODP00000015623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]