SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015665 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015665
Domain Number 1 Region: 20-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-31
Family V set domains (antibody variable domain-like) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015665   Gene: ENSMODG00000012514   Transcript: ENSMODT00000015955
Sequence length 125
Comment pep:novel chromosome:BROADO5:3:525201764:525202428:1 gene:ENSMODG00000012514 transcript:ENSMODT00000015955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLTFCSGSLSQAVVTQPPSVSAALGSSARLSCTLSSELSGNYVYWHQQSPG
KAPRYLLLVTSSGGTSRGDGIPERFSGSGSGTNRFLSISNVQAEDEADYFCQSDYYDSGS
YAYTQ
Download sequence
Identical sequences F6Q0M3
ENSMODP00000015665 ENSMODP00000015665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]