SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015667 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015667
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-31
Family V set domains (antibody variable domain-like) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015667   Gene: ENSMODG00000012516   Transcript: ENSMODT00000015957
Sequence length 125
Comment pep:novel chromosome:BROADO5:3:525216305:525216976:1 gene:ENSMODG00000012516 transcript:ENSMODT00000015957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLTFCSGSLSQDVVTQPPSVSAALGSSARLSCTLSSASSRYYVGWHQQSPG
KPPRYLLYVGSSGGTGRGDGIPERFSGSGSGTNRFLSISNVQPEDEADYFCQTYYSSGGS
YASTQ
Download sequence
Identical sequences F6Q0K2
ENSMODP00000015667 ENSMODP00000015667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]