SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015767 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015767
Domain Number 1 Region: 36-110
Classification Level Classification E-value
Superfamily Immunoglobulin 5.36e-16
Family C1 set domains (antibody constant domain-like) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015767   Gene: ENSMODG00000012605   Transcript: ENSMODT00000016057
Sequence length 184
Comment pep:novel chromosome:BROADO5:6:283847974:283872623:-1 gene:ENSMODG00000012605 transcript:ENSMODT00000016057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLHYQGNHCDNNDWIKNFGEGTQLVILQSESAFKKKPPKPIFFLPTSEEIKQKQSGTYIC
LLEDFFPNVVKTYWKEDGNSQPLDAQFGPITGGGNSYSQVSWLTVKEDVLRKNLTYFYQH
EDLGMEPKAFSISSVREKGLVELHFANMSAYYTYTILLMKSITYFAVILFFLYQKRVVKS
PGAK
Download sequence
Identical sequences F6PI60
ENSMODP00000015767 ENSMODP00000015767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]