SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015837 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015837
Domain Number 1 Region: 106-185
Classification Level Classification E-value
Superfamily Immunoglobulin 7.19e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 23-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000416
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015837   Gene: ENSMODG00000012659   Transcript: ENSMODT00000016128
Sequence length 206
Comment pep:novel chromosome:BROADO5:Un:101030214:101031211:-1 gene:ENSMODG00000012659 transcript:ENSMODT00000016128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKNQHSHFLSILCTAPLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAG
LRIQLSPDRRTLTLRSLTRSYNKGPYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSAD
EYPPGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGL
TRTTTKNIIIYGEYLDWAPNSVWGSL
Download sequence
Identical sequences H9H6K8
ENSMODP00000015837 ENSMODP00000015837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]