SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015857 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015857
Domain Number 1 Region: 422-559
Classification Level Classification E-value
Superfamily TIMP-like 1.44e-31
Family Netrin-like domain (NTR/C345C module) 0.031
Further Details:      
 
Domain Number 2 Region: 202-297
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 376-428
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 315-371
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000129
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 116-166
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000129
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 30-81
Classification Level Classification E-value
Superfamily Elafin-like 0.000000183
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015857   Gene: ENSMODG00000012674   Transcript: ENSMODT00000016149
Sequence length 567
Comment pep:novel chromosome:BROADO5:2:184660308:184671354:-1 gene:ENSMODG00000012674 transcript:ENSMODT00000016149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSWRFWVCWGPLAALLLLEMPPVGQALPPIRYSHAGICPNDMNPNLWVDAQSTCKRECE
TDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPREATCDHFMCLQQGSECDIWD
GQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHLTWPNTSPP
PPETTLSPTTVSPETPMMDVAAPALLNHPHHQSVRVGETVSFLCDVVGRPRPEITWEKQL
EDRENVVMRPNHVRGNVVVTNIAQLVIYNAQPQDAGIYTCTAKNAAGLLRVDFPLSVVRG
QVATSELRPNGTAFPMNECLKPPDGEDCGEEQTRWHYDAQANNCFTFTFGNCYHNHNHFE
TYEACMLACMSGPLAVCGLPALQGPCKAYSPRWAYNAQTGQCQSFVYGGCGGNGNNFESR
EACEETCPFPRGGQRCRACKARQKLVTSFCRSDFVILGRVSEVTEELDSGRALVTVEEVL
KDEKMGLKFLGQEPLEITLLHMDWACPCPNITVSEAPLIIMGEVDGGMAVLQPDSFVGPS
SVRRVRKLREVLHKKTCELLKEFLGLR
Download sequence
Identical sequences F6VGY3
ENSMODP00000015857 13616.ENSMODP00000015857 ENSMODP00000015857 XP_003340244.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]