SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015894 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015894
Domain Number 1 Region: 26-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000003
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015894
Domain Number - Region: 120-222
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 0.0112
Family ADP-ribosylglycohydrolase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015894   Gene: ENSMODG00000012703   Transcript: ENSMODT00000016186
Sequence length 242
Comment pep:novel chromosome:BROADO5:1:432537140:432542993:-1 gene:ENSMODG00000012703 transcript:ENSMODT00000016186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQRGPISALRYLLLHAPLLLIANATFTEVPKDVTVREGEDIEMPCAFRASGSTSYSLEI
QWWYLKDPPRELAHELALSAPGSRNKPTSTDPTKASTVRVQGNDISHRLRLSAVRRQDEG
VYECRVSDYSDDETQEHKAQALLRVLSRFAPPDMQAAEAVSHIQSSGPRRHGAAGRATSE
PGRDKRPPGETGPANAAAAAAAAAAAGAAAAAAAAAAAATAASSASPPPGRAVILRQRHG
SG
Download sequence
Identical sequences F6UY85
ENSMODP00000015894 ENSMODP00000015894 13616.ENSMODP00000015894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]