SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015969 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015969
Domain Number 1 Region: 970-1262
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-79
Family Protein kinases, catalytic subunit 0.000000000171
Further Details:      
 
Domain Number 2 Region: 322-488
Classification Level Classification E-value
Superfamily L domain-like 4.54e-53
Family L domain 0.0000000894
Further Details:      
 
Domain Number 3 Region: 30-184
Classification Level Classification E-value
Superfamily L domain-like 9.07e-42
Family L domain 0.000000339
Further Details:      
 
Domain Number 4 Region: 484-603
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-29
Family Fibronectin type III 0.0000145
Further Details:      
 
Domain Number 5 Region: 780-923
Classification Level Classification E-value
Superfamily Fibronectin type III 5.04e-21
Family Fibronectin type III 0.0000829
Further Details:      
 
Domain Number 6 Region: 606-686,786-824
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-21
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 7 Region: 164-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015969   Gene: ENSMODG00000012761   Transcript: ENSMODT00000016263
Sequence length 1361
Comment pep:novel chromosome:BROADO5:1:136784077:137155508:-1 gene:ENSMODG00000012761 transcript:ENSMODT00000016263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGRGSPTSLWGLLFLFSTLCLWPTNGEICGPHIDIRNEIQELKRLENCTVIEGYLRILLI
SKAEDYRNFRFPKLTVITDYLLLFRVAGLESLSDLFPNLTVIRGKNLFYNYALVIFEMTN
LKEIGLYNLRNITRGAIRIEKNSELCYLSTVDWSLILDAVSNNYIVGNKNPKECGDLCPG
TMEEKPLCEKTTINNEYSFRCWTTNHCQKMCPSSCGKRACTDQNECCHPECLGSCSAPDN
NTACVACRHYYYAGTCVPTCPPNTYKFEGWRCVDKDFCASVLSAETSEFEKFVIHNDECM
QECPSGFIRNGSQSMYCSPCEGPCPKVCEGEKKTKTIDSVTSAQMLQGCTVFKGNLLINI
RRGNNIASELENFMGLIETVTGYVKIRHSHALVSLSFLKNLRYILGEEQLEGNYSFYVLD
NQNLQQLWDWNLHNLTIKEGKMYFAFNPKLCVSEIYRMEEVSGTKGRQSKGDINTRNNGE
RASCESDVLHFISNTTMKNRIKLTWQRYRPPDYRDLISFTVYFKEAPFKNVTEYDGQDAC
GSNSWNMVDVDLPPNKDVKPGILLQGLKPWTQYAIYVKAVTLTMVENDHIRGAKSEIVYI
RTKAAVPSIPLDVISASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRHNYCS
KDKVPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFEN
FLHNSIFVPRPERRRRDVFQIANSTMPSRNRNTTVADHFTNMSDAEEIETEYPFFESRVD
NKERTLISHLRPFTLYRIDIHSCNHEADTLGCSASNFVFARTMPAEGADNIPGPVLWEER
PDNTVHLKWPEPENPNGLILMYEIKYGQQVEDQRECISRQEYRKFGGAKLTRLNPGNYSA
RVQATSLSGNGSWTDPVFFYVPPKTGQDYENFLHLMIALPIAGLFIVGGLLIMWYVFNKK
RNSDRLGNGVLYASVNPEYFSAADVYVPDEWEVPREKITMSRELGQGSFGMVYEGTAKGV
VKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMEL
MTRGDLKSYLRSLRPETENNPCQMLPTLKKMIQMAGEIADGMAYLNANKFVHRDLAARNC
MVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVV
LWEIATLAEQPYQGMSNEQVLRFVMEGGLLEKPDNCPDMLFELMRMCWQYNPKMRPSFLE
IIGSIKDELDPGFKEVSFFYSEENKPPDTEELDLETENMESIPLDPSSTLQPADKHSGHK
AENGPGVVVLRASFDERQPYAHMNGGRKNERALPLPQSSAC
Download sequence
Identical sequences F6SJA3
13616.ENSMODP00000015969 ENSMODP00000015969 ENSMODP00000015969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]