SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016029 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016029
Domain Number 1 Region: 613-893
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.84e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000216
Further Details:      
 
Domain Number 2 Region: 897-1208
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-78
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000751
Further Details:      
 
Domain Number 3 Region: 387-546
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000049
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number 4 Region: 291-401
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000793
Family Fibronectin type III 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016029   Gene: ENSMODG00000012814   Transcript: ENSMODT00000016326
Sequence length 1287
Comment pep:novel chromosome:BROADO5:2:99547094:99690157:1 gene:ENSMODG00000012814 transcript:ENSMODT00000016326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLWLKLLTFGFAFLDTDIFVTGQMTPNGLAGPSESEKPYTPFPTGPPPTHSTASLPASI
SERETGATGTIPPLNPHITPGAPPTKSTHLTTHAVSQAPSDGSVNQTLSSSPAVLTTLIA
DRANKSTDHIPERLTPTSLPADSSSASVTDLNPARNSSAVLPTLTTAITITDNTSDISDP
PIAPTIIATASKSSSTIPVTDTSTIAPSSRPVLCDRFKNISVTYEYNFRKFTACVNITEN
ETRYLYPTSDGCYGNLTECSSINIYVIPCPNENFTLYVPPAKDQFNLVNITEVEEADTSI
SLRWTYNRNFDCTQPLIFSFECKDPNGTIHSKKSEQYMTKFNNLIPDTDYICHASVNYER
HLVQQDQINIKTDFRTPGETTNLTLSATETEMNISWVAPSGTFHGFLIHSNRFSEDIKLS
NASTNHILQDLQPYEMYDISVRAFTSGKTQRYGKEVTDSVRTDIGKPSKVNDMEIKLEGD
NLIKVECKEPDKIYGPKLVYHLNMTSLYGLKSENNSTCKFIFNNLHFMTNYTFKLYTYNG
KHYGDAVVKSEVTRYNSHALIMFLIFLIVVTSLALLIVLYKIYDLHKKRSSSTDEQIGLV
EKDDEKQIMNVEPIPSEMLLETYKRKVADEGRLFLAEFQSIPRIFSKFSSKDARKPFNQN
KNRYVDILPYDYNRVELSEVNGDAGSDYINASYVDGFKEPRKYIAAQGPREETVDDFWRM
VWEQKVTVIVMVTRCEEGNRNKCAEYWPTVEVGTQTYGDVIVKINEHKRCPDYIVQKLNI
TNKRERTNGRDVTHIQFTSWPDHGVPDDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGR
TGTYIGIDAMLEGLEAENRVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFGETE
VGMSELHSYLNNMKKRDPPSEPSPLEAEFQRLPSYRNWRSQHTGNQEENKNKNRNSQIIP
YDFNRVLLKHELETSKESEHDSEESSDDDSDTDEPSKYINASFITTYWKPEVMIATQGPL
KETIADFWQMVFQRKVKVIVMLTDLKDGEQDVCAQYWGEGKQKYEDVEVEIKDMNKTTAY
TIRVFELRHAKRKDARTVYQYQYNSWKGEELPASPRELISMIRNFKEKLPKKHSTEAQKH
HKTASLLIHCRDGSQQTGMFCALLNLLDCADTEDVIDVFQVVKSLRRARPEMVSSFEQYQ
FLYDVIANTYPAQNGQVKKSSHQEDKIEFDNEVDIPNQVANCVSSSADLDKAQDKSRKAE
EPQNTDGTKETESSSNGPTSTTLTESA
Download sequence
Identical sequences F7DYM2
XP_007481084.1.35504 ENSMODP00000016029 ENSMODP00000016029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]