SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016082 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016082
Domain Number 1 Region: 591-797
Classification Level Classification E-value
Superfamily Fibronectin type III 2.78e-33
Family Fibronectin type III 0.00057
Further Details:      
 
Domain Number 2 Region: 797-979
Classification Level Classification E-value
Superfamily Fibronectin type III 3.49e-27
Family Fibronectin type III 0.0004
Further Details:      
 
Domain Number 3 Region: 494-597
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-19
Family I set domains 0.028
Further Details:      
 
Domain Number 4 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-19
Family I set domains 0.00041
Further Details:      
 
Domain Number 5 Region: 400-499
Classification Level Classification E-value
Superfamily Immunoglobulin 6.96e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 6 Region: 316-398
Classification Level Classification E-value
Superfamily Immunoglobulin 3.84e-16
Family I set domains 0.00019
Further Details:      
 
Domain Number 7 Region: 30-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000243
Family I set domains 0.00069
Further Details:      
 
Domain Number 8 Region: 126-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000914
Family I set domains 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016082   Gene: ENSMODG00000012850   Transcript: ENSMODT00000016379
Sequence length 1007
Comment pep:novel chromosome:BROADO5:8:9252100:9387658:1 gene:ENSMODG00000012850 transcript:ENSMODT00000016379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMWLLISYLITMCFISCLAVAEDGKGFGPIFEEQPIDTIYPEESPDGKVSLNCRARASP
FPVYKWRMNNWDIDLTNERYSMVGGNLVINNPDKLRDAGKYFCLVSNIYGMVRSTEATLS
FGYLDPFPPEERAEVKVKEGIGLVLLCDPPYHFPDDLSYRWLLNEFPIFITMDKRRYVSQ
TNGNLYIANVEASDRGNYSCFVSSPSITKSVFSKFIPLIPLSDRTTKLYPADIKVQFKDT
YALMGHNVTLECFALGNPVPEIRWRKVLEPMPSTAEISMSGAVLKIFNIQLEDEGTYECE
AENIRGKDRHQARIYVQAFPEWVEHINDTEADIGSDLYWPCVATGKPIPTIRWLRNGYAY
HKGELRLYGLTFDNAGMYQCIAENAHGAIYANAELKILAMAPTFEMNPMKKKTLAAKGGR
VLIECKPKAAPKPKFSWSKGTEWLVNSTRILIWDDGSLEIRNITRADEGTYTCFAENNRG
KANNTGTLLITDATRITLPPANADVTVGENATMQCSASHDPALDLTFIWSLNGYVIDFSK
ENSHYMRNFMIDSNGDLLIKKAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGVR
IEDIRDTSVALTWSRGSDNHSPISKYSIQTKTILSDDWKDAKTDPSNIEGNMESARAVDL
IPWMEYEFRVVATNILGTGEPSLPSNRIKTEGAAPNVAPSDVGGGGGSNRELTITWVPLS
REYHYGNNFGYIVAFKPFGGKEWKKVTVTNPDIGRYVHKDETMSPSTEFQVKVKAFNNKG
DGPFSLTAVIYSAQDAPSEAPTDVSIKVLSSSEISVSWKHVLEKTVEGYQIRYWAAQDKE
AAAQRVQVSSQDYSAKLENLLPDMQYSVEVRAYNSAGYGPPSDVIDVSTRKAPPSQPPRI
ISSVRSGSRYIITWDHVKAMSNESTVTGYKVLYRPDGEHEGKLYSTHRHSIEVPIPRDGE
YVVEVRAHSDGGDGVVSQIKISGASEVSPSLFGLLLPAFGVLAFWEF
Download sequence
Identical sequences F7C9P7
ENSMODP00000016082 XP_007502621.1.35504 ENSMODP00000016082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]