SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016088 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016088
Domain Number 1 Region: 21-111
Classification Level Classification E-value
Superfamily Immunoglobulin 5.5e-34
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016088   Gene: ENSMODG00000012857   Transcript: ENSMODT00000016385
Sequence length 119
Comment pep:novel chromosome:BROADO5:3:525791755:525792812:-1 gene:ENSMODG00000012857 transcript:ENSMODT00000016385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTLLLFQLLTLCIGSMAAYVVTQPPSVSMSLGEQVSLSCDGDGIGNNYVSWYQQKPGQ
AILPLIYGDSNRPEGIPERFSGSNSGNTATLSISGLQAEDEADYYCLASGSSGVHSDTD
Download sequence
Identical sequences F7C9L0
ENSMODP00000016088 ENSMODP00000016088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]