SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016155 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016155
Domain Number 1 Region: 64-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000783
Family I set domains 0.052
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016155
Domain Number - Region: 273-313
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0636
Family TNF receptor-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016155   Gene: ENSMODG00000012909   Transcript: ENSMODT00000016454
Sequence length 325
Comment pep:novel chromosome:BROADO5:2:197902174:197915616:-1 gene:ENSMODG00000012909 transcript:ENSMODT00000016454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGWVLLPAVLLFLAGGVGEQFSVPEKTYIYGNIGHPVKIYVKMYQNSPFLACMDNELS
QTEIIDPIALWMGPNGKHLKETNHTSLTPEGKLMITNFRESMSGSYVCILTYKLVSEETQ
KEQEIYNTYTFMIFGYQEPDYAYQMAVRFTTDSCNGKKNSQFFQLLTKMLEDIVFDLTCH
IEEPSYKCHLLEIPKHKLKDQIFIAFRVRPFPEGVRDACRKVLNCEEITNSKVHQARNRI
EEFFLQQTVVLENEFNFIPDIHYIDHSFKVIRIDSCRPGFGKNDILHSDCASCCVVCDPR
TYSPDMDVTCQACLTVHRYGAKMCP
Download sequence
Identical sequences F7GKP7
ENSMODP00000016155 13616.ENSMODP00000016155 ENSMODP00000016155 XP_007482358.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]