SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016191 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016191
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000414
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016191   Gene: ENSMODG00000012942   Transcript: ENSMODT00000016491
Sequence length 200
Comment pep:novel chromosome:BROADO5:2:283881188:283887939:-1 gene:ENSMODG00000012942 transcript:ENSMODT00000016491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQNITFGCGYNFGKYFRAIKAWQRLGASGPFETLAQTMNNNGEPSFIQVGRYLLEDDPPN
SMLKVTILELQREDAGLYQCVIYRPPQVVDILYRPIRLKTCNGDKIPTITPTPQGLTFRR
EKTSIPFTTEAYSPTNPKFHTQAPVKSTTDSLSTTLRAKDKDIIFPVYRLSHVLAVTLGI
FLNKSLVFITLYILLRKKTG
Download sequence
Identical sequences F7G1L0
ENSMODP00000016191 ENSMODP00000016191 13616.ENSMODP00000016191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]