SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016233 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016233
Domain Number 1 Region: 7-153
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.01e-33
Family Reprolysin-like 0.0049
Further Details:      
 
Domain Number 2 Region: 248-304
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000916
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 3 Region: 603-668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 990-1054
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 1223-1332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000785
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 
Domain Number 6 Region: 875-935
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 7 Region: 939-995
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000746
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Domain Number 8 Region: 672-728
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000811
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1115-1199
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000419
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016233
Domain Number - Region: 758-815
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000693
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 550-608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000732
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number - Region: 812-875
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00183
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016233   Gene: ENSMODG00000012967   Transcript: ENSMODT00000016533
Sequence length 1346
Comment pep:novel chromosome:BROADO5:1:460733865:460781182:1 gene:ENSMODG00000012967 transcript:ENSMODT00000016533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILTEPEAHLNITTNLTSSLLSVCEWSQRINPPDDTHPHHADLVLYITRFDLELSDGNK
QVRGVTQLGGACSSSWSCLITEDTGFDLGVTIAHEIGHSFGIDHDGAETNSCSSNDHIMA
PGGTPNSIGLTWSKCSREQFLRFVSTGKASCVNDLPHLEGTIPRAEPGLYYGADEQCRVA
FGSAAVACTFSRDDVDMCQVLSCHTDPQDQTSCSRILIPLLDGTECGVNKWCSKGHCRSL
EELTPVSLVHGQWSSWGLPSTCSRTCGGGVITRRRQCNNPRPAFGGHDCTGADLKAELCN
TQACVKTQLEFMSEQCAATDQKPLYLTPGIPTFYSWKSAAQYSQGNDLCKHLCWAAGKNF
IVSRGESFLDGTRCVPSDHQAVGTSSLCVMGKCRVFGCDGRMDSGLVKDVCQVCGGDNTT
CSRVSGSYTGGRAQEYVTFLTILPNFTTVLITNQKPLFTHLAVKVRGHYVVSGKRRISSN
TTHPSVLEDKQIEYRVFLTEEKMPHLEEIRIRGPTQEDIEIQVYRKYGNEYGNLTRPEIT
FSYFKPKQQQSWVWAGVRGPCSVSCGEGVRQVSYSCFDQEQNKWIDDVYCGGTVQPLLWQ
ELCVPGPCTPHWAAGDFGPCSTTCGGGVRERTVSCVKVEGNLTLTLPESYCKASLQPTAT
ETCNPQPCLTRWKVSEPGPCSSVCGLGLAQRNVTCMEEGDGLEGLVDDSLCSMEEKPSHL
LPCVVTVCPLGWNTQEPGSFPEEALDQLGASWKENLTVYVWSPLIGECSVSCGTGLRELR
YVCLDFASRKEVQEAKCNPVSQPANQMMICHAASCPPRWEIKALAPCPVTCGGGKVPLSV
HCVRQDKGLTISLPHSKCGGMPRPSSYQDCSPEPCPARWRHKLASCSVSCGGGVVQRILY
CARAFGENEEEIVPDIQCQELPRPEEQEPCSLDPCPPRWKIASTSSCSASCGLGTAMRSM
ICVQLDHGEEAEVEEEACATLERPPASIPCIIADCTYQWHFSDWTECSTSCGNGIQRRHD
FCVQPHQSHTPVPAIFCQHIPKSVTVRGCSAGPCGRQVTPKMKTQEEATTTLSPTTAAPT
LILESPQNRALAIPNNQFSSSIQAKEHLRQEENTGSCGKQYLEPSGTINMTGMPLAKCVV
AIGRPLGEVVAFRVLESSLNCSVGEMLLFWGRLTWRKTCKNLAGVTFISKTNTLVMRQRA
VLPGSRVVLQYWSQVATENYHKECDVQLFGPRGEIVSPPRDQNMRNQGGCRVFINVAPGA
RIAIHALAIDLGTEANQTSDSYISIRDMHNMKMITFHGQQLFYWESEGSRAEIEFSESFQ
EDNINFRGQYWILRVKGKSSSRDDLK
Download sequence
Identical sequences F7DB79
ENSMODP00000016233 ENSMODP00000016233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]