SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016249 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016249
Domain Number 1 Region: 22-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000183
Family I set domains 0.057
Further Details:      
 
Domain Number 2 Region: 119-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000532
Family C2 set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016249   Gene: ENSMODG00000012990   Transcript: ENSMODT00000016549
Sequence length 388
Comment pep:novel chromosome:BROADO5:4:225344524:225378330:-1 gene:ENSMODG00000012990 transcript:ENSMODT00000016549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILWTALSLLAWFPLQEASLIDHMETVIVEEGQMLTLKCVISQAKEASLQWLSPSGFTIF
FDKHPALKNQKYQLLHHSDDQLTIGISNVTLQDEGVYKCLYYSKPVRTKEVNVTVLATPS
KPTLEALTIRTTNGKEVLLRCFTKGSKPPPQITWLLSNGMELYGETQHTFEDEGKKCNTT
STLRVRAYGENATAHCLVRHEGLREEKLVVPFRFEDLVTAPDSDNVENSTLSFQPSQNST
ELVMEEFSTVDIDTLGHEQTQKFDIAEGNRSALEVTKRKHGILLLTLVSSLILVLFIVVQ
LFIMKLRKAHVIWKKENDISELTLESYRSRSNNDDTSSQEKNSQTFHHKCGMKYIITSYM
ERKSKNLKENIQDSTSKQEQNNLPETII
Download sequence
Identical sequences F7CS46
ENSMODP00000016249 ENSMODP00000016249 XP_016289273.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]