SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016287 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016287
Domain Number 1 Region: 767-1019
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-46
Family YWTD domain 0.00000636
Further Details:      
 
Domain Number 2 Region: 114-272,435-622
Classification Level Classification E-value
Superfamily Sialidases 2.55e-33
Family Sialidases (neuraminidases) 0.049
Further Details:      
 
Domain Number 3 Region: 1566-1751
Classification Level Classification E-value
Superfamily Fibronectin type III 3.38e-28
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 1941-2107
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000171
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 5 Region: 1422-1461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000157
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 6 Region: 1159-1200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 7 Region: 1202-1240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 8 Region: 1330-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000877
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1082-1120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 1375-1410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 11 Region: 1754-1852
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000328
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 12 Region: 1245-1278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 13 Region: 1477-1514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1517-1556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 15 Region: 1123-1161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 1281-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016287
Domain Number - Region: 1842-1935
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0238
Family Fibronectin type III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016287   Gene: ENSMODG00000013024   Transcript: ENSMODT00000016588
Sequence length 2221
Comment pep:novel chromosome:BROADO5:4:226932556:227157771:-1 gene:ENSMODG00000013024 transcript:ENSMODT00000016588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGSSCGEPRLPLLFALVALLPPWALTETRSLQSAGGRAALPQERGFFVLQGGMGQPWL
PGHSGGRDAAGGASRPAGEPRPPRTRRSAAAHQLEPVKVYGQVSLNDSHNQMVVHWAGEK
SNVIVALARDSLALLGPKSSDVYVSYDYGKTFQKISEKFNFGMGNSSEAVIAQFYHSPAD
NKRYIFVDAYAQYLWITFDFCSTVQGFSIPFRAADLLLHTKAPNLLLGFDRSHPNKQLWK
SDDFGQTWVMIQEHVKSFAWGIDPYDKPNTIYIERHEPTGSSTVFRSTDFFQSRENQEVI
LEEVKDFQLRDKYLFATKVVHLLGSQQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIAD
ASEDQVFVCVSHSNNRTNLYISEADGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFAD
FHRVEGVQGVYIATLINGSLSEENMRSVITFDKGGTWEFLQAPAFTEYGEKIDCELSHGC
SLHLAQRLSQLLNFQLRRMPILSKESAPGLIVATGSVGKNMASKTNVYISSSAGARWREA
LSGPHYYTWGDHGGILMAIAQGMETNQLKYSTNEGETWKTFSFSEKPVFVYGLLTEPGEK
STIFTIFGSYKENGHSWLILQVNTTDVLGVPCTENDYKLWSLSDERGNECLLGHKTVFKR
RTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFANKPFSPP
VPCPVGSTYRKTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAMRKSIHRYD
LSSGAIEQLPVTGLRAAVALDFDYEHNCLYWSDLALDIIQRLCLNGSSGQEVIINSGLET
VEALAFEPLSQLLYWVDAGLKKIEVANPDGDFRLTIVNSSLLDRPRALALIPKEGLMFWT
DWGDLKPGIYRANMDGSSIYRIVSEDVKWPNGISVDDEWIYWTDAYLDCIERINFNGQQR
SVILDSLPHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILVSQLTGLMDMKIFYRG
KTTGNNACVSKPCSLLCLPKANHSKSCKCPEGVSSSILPSGELRCDCPRGYQLKNNTCIK
EENTCLRNQYRCSNGNCINSIWWCDYDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIP
LSYKCDLEDDCGDNSDESHCEAHQCRSDEFSCASGMCIRSSWVCDGDNDCRDWSDEANCT
AIFHTCEASSFQCHNGHCIPQRWACDGDADCQDGSDEDPINCEKKCNGFRCPNGTCIPSS
KHCDGLHDCSDGSDEQHCEPLCTRYMDFVCKNRQQCLFHSMVCDGIVQCRDGSDEDAAFA
GCTQDPEFHKVCDQFSFRCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQ
FQCENGHCIPNRWKCDKENDCGDWSDEKDCGDAHLLPPSTAAPSTCLPNYFRCNSGACIM
NSWACDGYKDCTDGSDEEACPTAANVSSTSTATQLGRCSRFEFECQQPKKCIPNWKRCDG
HQDCRDGMDESNCPTHSTLTCVSGRYMCEDGEACIVLTERCDGFLDCSDGSDERSCTEET
TIYKVQNLQWTADFSGDVTLTWTRPKKMPTASCVYNIYYRMVGESMWKTLETNSNKTISI
LKVLKPDTTYQVKVQVQCLTKVHNTNDFVTLRTPEGLPDAPRNLQLSLHKEVEGVILSHW
APPANTHGLIREYIVEYGRSGTKMWASQRAPSNYTEIKNLLVNTLYTLRVAAVTSRGIGN
WSDSKSITTIKGKVIPPPSIHIESYTENSLSLTLVMDSNFKVNGYVVNLFWAFDTHRQEM
RTLFLHGEITSHKVNNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGTRPPSPSLKAKAT
NQTAVECTWTGPRNVVYGVFYATSFLDLYHNPKNLTTSFHNSTVIVNRDEQYLFLVRVIA
PYQGPPSDYIVVKMIPDNRLPPRHLHAVDISKTSAVIKWESPYDSPDQDMLYAVSVKDLI
RKADRNYKVKSRNSTLEYLISKLEPGGKYHIIVQLGNMSKEASVKISTVSLSAPDALKII
TENDHVLLFWKSLALKEKYFNESRGYEIRMYDSVMNITAYLGNTTDNFFKISNLKLGHNY
TFSVQARCLLSGQICGEPAVLLYDELGFGADASAFQAGRSTDVAAIVVPILFLLLVTVGI
GFIVLYTRHRRLQNSFTAFANSHYSSRLGSAIFSSGDDLGDDDEDAPMITGFSDDVPMVI
A
Download sequence
Identical sequences F7BP31
ENSMODP00000016287 XP_001370262.1.35504 ENSMODP00000016287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]