SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016318 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016318
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-33
Family V set domains (antibody variable domain-like) 0.0000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016318   Gene: ENSMODG00000023060   Transcript: ENSMODT00000016619
Sequence length 123
Comment pep:novel chromosome:BROADO5:1:713134176:713134850:1 gene:ENSMODG00000023060 transcript:ENSMODT00000016619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPCQLLWLLVLWAQDSRGAIMLTQSPASLSRSAGETVTISCRATESLTESILGITLQN
LHWYQQKPGQAPRLLIYDATNLASGVPGRFRGSGSGTDFTLTISSLEPEDAGEYYCQQSN
SFP
Download sequence
Identical sequences F7GBG0
ENSMODP00000016318 ENSMODP00000016318 13616.ENSMODP00000016318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]