SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016320 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016320
Domain Number 1 Region: 14-110
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-34
Family V set domains (antibody variable domain-like) 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016320   Gene: ENSMODG00000013072   Transcript: ENSMODT00000016621
Sequence length 112
Comment pep:known chromosome:BROADO5:1:713115854:713116401:1 gene:ENSMODG00000013072 transcript:ENSMODT00000016621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLLLFWLSGSQGEVVLTQSPASVSVSLGDRVTIKCKASQSLLHSDGNTYLHWFQQKVGKP
IKSLIYRVSNLHSGVPPRFSGSGSGTDFTLTISSLEPEDAAIYYCFQGTHWP
Download sequence
Identical sequences F7GB88
13616.ENSMODP00000016320 ENSMODP00000016320 ENSMODP00000016320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]